DPCstruct | MC10958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 160 ± 31 aa |
| Standard deviation of domain lengths | 31.18 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 71.17 |
| Assigned Pfam label(s) | PF20417- PF09793- PF09532- PF21166- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W3I294 | 9-135 | NHNDVLLINLAYVSDVKTINDRTETPPPLASLNVNKLASRARTEKEEKLSQAYAISAGVSPEGQQLFQTIHKTLNDCKWQEKSILVM… |
| A0A0L0DP45 | 12-166 | GELFTYDARSGMVVFQDASRFPKRKLVLLREEAIASMVLLAPPPEGLADSLGALHAAHMATVHTPPETIRKRETAALRADYAEADKI… |
| A0A0B7MQM6 | 30-199 | None |
| A0A2I4DAI6 | 16-207 | None |
| A0A077WT19 | 11-153 | None |
| A0A183T2U9 | 92-266 | None |
| A0A1X6PEK0 | 15-157 | None |
| A0A1S8X6C1 | 9-179 | None |
| A0A674GKG6 | 10-186 | None |
| E9IL15 | 6-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.