DPCstruct | MC10957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 600 ± 78 aa |
| Standard deviation of domain lengths | 78.49 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 98.70 |
| Assigned Pfam label(s) | CL0226- CL0602 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0DK46 | 56-651 | LCEPMSCGGESGYAGCQKTASGHEYGMGKQGTIMYSFDVPQDQDGVRMAFTHGMECSNHDQRQFAVNAVCADEGEADTLMYDGETSH… |
| A0A1J4JEV6 | 12-554 | LSYNIYRSDCVAVLDAYKYDLTRFTGQDAFIPSTDYATYYIRLCPDPTMTGSTMDVFVMQCPKKAGSLCRNIITQNSLDYKPRNAKN… |
| F0ZQH7 | 28-510 | None |
| A0A2G8L3W0 | 14-655 | None |
| A0A818XKV1 | 5-572 | None |
| A2DUW0 | 11-646 | None |
| A0A0S7KIH4 | 2-759 | None |
| P11717 | 1279-1979 | None |
| A0A7I2YQS7 | 47-626 | None |
| Q54D31 | 31-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.