DPCstruct | MC10956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 178 ± 16 aa |
| Standard deviation of domain lengths | 15.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6B9E8 | 1-176 | MDNETIKEALSYSLGSDMHEVWRNSRKREDGTYESRIKKSKDEEWNLAHGTDEVDIANCTFEELPSNWQYENLEAGRVAIGLVYEKV… |
| A0A0L0DD65 | 90-264 | LAAQDSLAQLLDKGAFKHGTSHEEYVRMVAARLHHKWRLNRMQPDGSFLPRPKLVDDVEYDIANLDYDELPERYKHENREAARVACE… |
| A0A1I3HUY8 | 141-295 | None |
| A0A7K0DIB1 | 1093-1260 | None |
| A0A7S2WT26 | 187-379 | None |
| A0A3M0YZ29 | 58-265 | None |
| A0A350PDD7 | 2-162 | None |
| A0A817D5C4 | 13-208 | None |
| A0A817K2L7 | 11-202 | None |
| A0A4Q3MD14 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.