DPCstruct | MC10954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 86.54 |
| Assigned Pfam label(s) | PF04419- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6M1Z6 | 424-502 | MGRTNASEAQRKRLDAAKRQAKHSGKGGESQLKNIAASQTLMCSICRQTFMCTQKKLLPAHAESKHPKQTFDQCFPGVS |
| A0A0L0DBT5 | 2-86 | VVMIGTIGLLVSCAQKSKIARERNAARKAAAGKGSQLKAIKKAQSIQCKVCFQTFMCTSSQASLQAHIDAKHSKLNKTFAGCFPD |
| A0A4D9A9I4 | 1-93 | None |
| A0A7S0DXD7 | 2-71 | None |
| A0A2U3EFN3 | 304-380 | None |
| A0A5J4WZK4 | 146-220 | None |
| A0A7R7XYD1 | 105-178 | None |
| A0A1E5VGA2 | 158-250 | None |
| A0A7J6LMQ4 | 8-79 | None |
| A0A7S2QQ54 | 108-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.