DPCstruct | MC10952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 324 ± 51 aa |
| Standard deviation of domain lengths | 50.76 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.30 |
| Pfam Score | 95.18 |
| Assigned Pfam label(s) | CL0409- CL0020- PF12004- PF08337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7KDH1 | 42-291 | MEKIMPEEEYSEFKEMILQKDFHAIYALANVCGQDRTLLASLLLRIFRHEKAEAPLLRTLNDREINMEDEATTLFRATTLASTLMEQ… |
| A0A0L0D6T2 | 14-337 | EGLLDVLLDDEMQLVEAIVSQMDICDADKLAKIFVHCFESRDMTLQLLERSVTREIEKTEYAQVLFRGNSLASKMMTVYSRLVGTQY… |
| A0A397F370 | 12-234 | None |
| A0A1I8IG18 | 168-516 | None |
| A0A0K0E8N7 | 771-1095 | None |
| A0A7R9KZL5 | 756-1076 | None |
| C3ZF12 | 232-463 | None |
| C4LU33 | 17-379 | None |
| C4LUL5 | 12-311 | None |
| F4PK80 | 303-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.