DPCstruct | MC10951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 537 |
|---|---|
| Mean domain length (aa) | 314 ± 72 aa |
| Standard deviation of domain lengths | 72.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.30 |
| Pfam Score | 77.76 |
| Assigned Pfam label(s) | CL0270- CL0500- CL0277- PF04621- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0D660 | 109-447 | MNDEPVVRVPLKRLGLIVNPLSGNKKGVRIVSDILRPVFEDEFGIEVKVFETEYAGHAVVLAETIDTSKLDGLVVAGGDGSFHEVVN… |
| A0A1E3TG71 | 1-200 | MNTTVLVFGAGRLPRALRGLPVAQVDSAVETARRLIVVGSDADLAGVLTRLLRADRLDVEVAYVSRRRSPATRAYRLATRWRAARRA… |
| A0A0K0EBU9 | 1115-1478 | None |
| A0A1I8IVF2 | 5-290 | None |
| A0A446Q137 | 2-230 | None |
| A0A6I8VVH6 | 81-369 | None |
| A0A1D2N9J9 | 889-1092 | None |
| A0A7S4PPD8 | 117-474 | None |
| A0A5B7DBT3 | 11-257 | None |
| A0A7R9PPH4 | 2-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.