DPCstruct | MC10950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 236 ± 41 aa |
| Standard deviation of domain lengths | 41.42 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0D573 | 5-236 | AQELLVTLQEPDAIMEADILSRLRAYIGCKGAPQTAVETLAASYQGHAEVCNVLLDWMGLVGMDKEEREGLVVNHVKDSVLAHYDAK… |
| T1I739 | 6-223 | EVLRECLEKFSTPDYIMEPGIFSQLKRYFQAGGSPEQVIELLSHNYKAVAQMANLVAEWLILGGVKVTNVQAMVENHLKEMILKTFD… |
| A0A803J950 | 175-428 | None |
| A0A182JJ12 | 24-219 | None |
| A0A0R3QDX8 | 2-186 | None |
| S4RLJ1 | 14-197 | None |
| A0A835XT62 | 7-292 | None |
| A0A7S4NQF7 | 4-161 | None |
| A0A6V7XDJ8 | 24-237 | None |
| A0A8B6CN48 | 325-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.