DPCstruct | MC1095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 183 ± 22 aa |
| Standard deviation of domain lengths | 22.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF05103- CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A221VYN2 | 3-156 | LTAAQVRQAVFARADLLRRGYHVGEVDTFLERVALALEGRAELSSAEVESVAFSRSPWGTRGYHEDDVDVFLDRVHQALADRAGEKK… |
| A0A7C9VWR9 | 61-232 | PKLTAADIRKVAFHRPPRGRRGYQESQVDAFLDRIEATLLGQDNLTGKDIRDVRFSRPLIGRRGYDETEVDAFLGQIEQQLAGPMRS… |
| A0A1F1B293 | 10-219 | None |
| A0A1T4N404 | 2-194 | None |
| A0A2A3AHR4 | 49-252 | None |
| A0A1G9ZJY5 | 3-181 | None |
| A0A1G6RDC3 | 9-185 | None |
| A0A7J5BPG2 | 26-218 | None |
| A0A251XTY9 | 335-531 | None |
| A0A086YZN1 | 12-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.