DPCstruct | MC10947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 259 ± 57 aa |
| Standard deviation of domain lengths | 56.98 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838TJN3 | 12-209 | DKAFEVAYEDIKTAFEFYLKNYNNNRPIIIASHSQGTLHAGKLLKEFFENKPLQQRLICAYIIGLPVFTDYFQTLQPCKDSTATGCF… |
| A0A6J6N6C2 | 161-459 | DIAVDPPIDCFYVYPTTSEDATMASDFTAGAEINTTIMQAARFNQVCRVFAPIYRSVTSAGLSRAFSAGDPQFPAAWNQAYLDVLDA… |
| A0A7W8EEJ6 | 31-360 | None |
| A0A6B0ZF24 | 445-730 | None |
| A0A7X8P9F5 | 48-340 | None |
| A0A7C3CCJ8 | 23-269 | None |
| A0A2N2CKW5 | 24-269 | None |
| A0A7S0DNB1 | 124-444 | None |
| A0A7C5LPU3 | 6-220 | None |
| A0A806K1S3 | 151-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.