DPCstruct | MC10946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 258 ± 33 aa |
| Standard deviation of domain lengths | 32.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9D3D0 | 170-404 | WLSSHWTVRQGWGWRDGEDLFFRHLLDGSRAANRSGWQWTVGALTGKPYGFSRWQVEKRAPELCRRCPVSDACPIQDWPEDQRPEPR… |
| A0A6J6MXI6 | 2-230 | WLASHWTVRNEFGWLPGQEEMYRHLIDGSRADNLLGWQWTVGAGTGKPYGFARWQVQKRASELCTGCALKKSCPIEEFPLEVALDHA… |
| A0A543KWM8 | 115-370 | None |
| A0A4R2WKF1 | 116-397 | None |
| A0A821JXD9 | 109-343 | None |
| A0A2T2UCY7 | 69-357 | None |
| A0A1Y6CMF2 | 28-293 | None |
| A0A2E9FL75 | 2-228 | None |
| A0A6L6AJF8 | 113-402 | None |
| A0A2E9G8M1 | 2-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.