DPCstruct | MC10945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 195 ± 32 aa |
| Standard deviation of domain lengths | 32.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09948 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0NMF6 | 69-266 | GLAGALAYLLLWGAMMLTMMLPSLLPAVRRYRDELCDAPSVFGPSIAAFVGAYGLVWTLAGAVPLAVDFLLSIRGLVTATIGGVDAG… |
| A0A6J6ML30 | 2-187 | WTLMTLVMMSTTAVPVLMSLRSIASNASQQIWWAFVFGYAVIWLGFALAASSLQLAIAELNLFDSQNGLNKILSGGLLITAGLYQFS… |
| A0A517WR49 | 55-268 | None |
| A0A160UVJ9 | 49-277 | None |
| A0A6G1YP25 | 47-278 | None |
| F6G111 | 1-153 | None |
| Q5LTK8 | 9-249 | None |
| A0A7V9NJ10 | 19-206 | None |
| A0A7I9YBY2 | 10-192 | None |
| A0A538LJM3 | 5-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.