DPCstruct | MC10944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 6.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E6PQB7 | 200-295 | SCLTIDGSQTDPYGNKWQRVTISGRVEKRGVVADVRTVWRQASKLYAAKCSRCHGLHHPSQFTANQWPGILQTMAKNAGLQEEQKAL… |
| A0A379LPU6 | 5-112 | IEKELSRDESVVTVKESKEDPMTGLEWQKVSGQFWVEDGLLMNSLEPAWDIASQTYDDNCSVCHRQPNPASHDANQWPGLWSGMVGF… |
| P95587 | 281-388 | None |
| A0A2S9RS40 | 2-112 | None |
| A0A6N2SZI7 | 23-130 | None |
| A0A6I1ECB9 | 1-97 | None |
| A0A2G6R5Z0 | 85-179 | None |
| A0A330H3H2 | 68-162 | None |
| A0A432J1P3 | 511-625 | None |
| C8NAR0 | 229-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.