DPCstruct | MC1094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9RVR7 | 37-138 | PPLPTTGDLVTDLVDALLSVPSIRDEPSRRTVLSRMRQEIADAVPHHQRARLHVFELVATCRNFEGGLDDLLRVLRELEGDSIPLRH… |
| A0A0A6UTM1 | 2-86 | RAVVDALENIPLMRDDYQRRLVLDLLPVRIRSGIADSTLPRVHLVAIVRGCEQDPAGRQALVEALRLVLGDDSPDFRNFDGVVRA |
| A0A1V5RCY5 | 105-195 | None |
| A7BRA4 | 7-95 | None |
| A0A2H3L5R1 | 63-162 | None |
| A0A428X2N6 | 211-293 | None |
| A0A3N1HGG8 | 179-286 | None |
| A0A3E0H2S7 | 201-300 | None |
| A0A1V5RDB1 | 266-364 | None |
| A0A6I4NB37 | 256-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.