DPCstruct | MC10939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 209 ± 36 aa |
| Standard deviation of domain lengths | 35.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0505 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139WZM3 | 34-248 | NLAEAELVNANFTKANLSYATFAGATLINANFTQADLSRATFVKANLQRANLSKTLALSTVFCEAKLTAACIESWTIDDTTLLEESL… |
| A0A0K0PDK2 | 1-229 | MDLEGARLQRVRLQEARLQGADLKRAHLSDLDLSRANLQGANLSKVIFSGTVLNDVQVDQATLENTNPLFPELLQAFVDRFSPPDGL… |
| A0A2H2XVP1 | 196-413 | None |
| A0A6G3Z0M1 | 516-788 | None |
| A0A7V8TR72 | 88-320 | None |
| U5DF25 | 125-327 | None |
| A0A316FXJ2 | 191-395 | None |
| A0A6C2TYA7 | 447-666 | None |
| A0A5P8WAL0 | 406-618 | None |
| A0A6L9Z312 | 382-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.