DPCstruct | MC10936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377CAF9 | 6-97 | INDITRASGGFAMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKALSPYASAILVDQQFCYRQVVEQNAIAKSCAMIVAADE… |
| A0A3S4S3F1 | 1-86 | MTKSIKPLLNDKNYIAALAIDQRGALKRLLGEDAKTEDLEQFKVHVSEELTPYASSILLDPEYGLPATKVRAENAGLLLAYEKNWL |
| A0A6L9IPD6 | 1-108 | None |
| A0A7V2VT76 | 2-98 | None |
| A0A212DKY2 | 20-131 | None |
| A0A562WF88 | 9-108 | None |
| A0A0G1LPB2 | 1-90 | None |
| A0A5E4IPS7 | 12-130 | None |
| A0A150NFV4 | 1-99 | None |
| A0A7C3HP22 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.