DPCstruct | MC10934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 238 ± 17 aa |
| Standard deviation of domain lengths | 16.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7RF54 | 2-219 | YFAAARWRDECLIGNNSLFSGQSVDGGSAAAELVAAFVEQPDIGDGKFVPKLKSQLANVSTDAVQVAAELLYIHFLIISTESIRGDT… |
| A0A4R2G8P7 | 12-219 | YLLENISEFNERCLIQGRSLFTELAVWNSPTCQELIDYFVENLDEGDGDFFEKLETQLADASPEAKVLASEMLWLMFLCPSNTGAES… |
| A0A7W1T235 | 9-262 | None |
| A0A4R6VCC0 | 5-253 | None |
| A0A839QP56 | 18-280 | None |
| A0A838I1P4 | 4-248 | None |
| A0A2N6FXA9 | 19-251 | None |
| A0A7K3LVF4 | 337-570 | None |
| I0IJ50 | 18-263 | None |
| K6VQM2 | 329-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.