DPCstruct | MC10929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 195 ± 49 aa |
| Standard deviation of domain lengths | 49.39 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 53.89 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF17846- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8Y326 | 1-232 | MMLNDRIQNLNSLQHVLRKAEEYLGTLPAETPYAELEHKFQEIGLERGWGDTAGRVLEMIQLLLDLLEAPDPCTLEKFLGRVPMVFN… |
| A0A2N9FW95 | 2-186 | MLNDRIQNVNALQYVLRKAEEYLTTLAPETPYSKFEHRFQEIGLERGWGDNAERVLGMIQLLLDLLEAPDPCTLETFLGKIPMVFNV… |
| A0A1D6P843 | 198-399 | None |
| A0A453Q7G6 | 9-202 | None |
| A0A453Q7W9 | 184-396 | None |
| A0A453Q809 | 1-209 | None |
| A0A835H3N0 | 316-505 | None |
| A0A835H493 | 136-323 | None |
| A0A835H5H8 | 2-88 | None |
| A0A287Y0J9 | 67-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.