DPCstruct | MC10927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7ECL3 | 3-91 | GDTGAPHQISLFRSQITTRRFNDQSLRILESLLVFKDVKSQIETRSDLKQFLRLESLSIFHEIKYKTVYQKLFILQFFVRAFALIGD… |
| A0A2N9FHU3 | 1-98 | MSDALAQQISLFRSLIKTRRFDDATLRILESVLVSNSVKSLKEVQSTLRVFLRSESLSVIREIAEKPVQQKLSILEFFVRAFALIAD… |
| A0A2I0KDI0 | 29-115 | None |
| A0A5A7PCQ0 | 85-176 | None |
| A0A5A7P6J2 | 4-92 | None |
| A0A5J5S660 | 2-86 | None |
| A0A803PWV3 | 5-78 | None |
| A0A6A6M4U2 | 57-145 | None |
| A0A6A4PBZ3 | 3-90 | None |
| A0A7I8K5L5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.