DPCstruct | MC10926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9FBX0 | 1-87 | MKSHVVMRKWISGIGVECIGKNLVHSKDGPPTFEQPKMTIEKLLECGNMLIQEQENVKRVQLADKYLREAALGDANKEAIKSGAFFG |
| A0A7X5CH40 | 46-140 | FFGALRARVYDDEVRKWVSNVGVENIGSKLVNSRDGPPSFAQPAMTLEKLLEYGNMLVQEQENVKRVQLADKYLKDAALGDANKDAI… |
| A0A6A5NTE7 | 327-429 | None |
| A0A835N0Z2 | 419-512 | None |
| A0A0D3A730 | 2-78 | None |
| E1ZSL5 | 202-275 | None |
| A0A426X122 | 249-342 | None |
| A0A2U1NN70 | 559-644 | None |
| A0A540NB19 | 79-172 | None |
| A0A2G9FYL0 | 94-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.