DPCstruct | MC10925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3BM25 | 3-88 | EKAASFHTVVNVVQALGRGFDVNYDTRLLYCKGVGGSRVVEISEEHCRDLWLYDDVVLPNVSEDINNFQEPAGRDGTSVCPYNEMV |
| A0A2N9F9U5 | 4-100 | PSAMENSETTRTRSFSCDALTTTLCNSIQALGRGFDVTSDIRLLYCKGAPGSRLVHLEEDNTRDLVVSDGVVVPNVPVEIHCSMGKT… |
| M0VBM1 | 5-92 | None |
| A0A6A2WBZ9 | 3-102 | None |
| A0A445EA06 | 3-73 | None |
| R7W4W3 | 1-81 | None |
| A0A2I0X519 | 3-90 | None |
| A0A396H873 | 112-233 | None |
| A0A3L6SU09 | 1-101 | None |
| A0A7J6UX82 | 10-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.