DPCstruct | MC10922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 296 ± 48 aa |
| Standard deviation of domain lengths | 47.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4T041 | 67-408 | EAEIQATMAAYAAAELNNSIVYAATASASHSCLTSALDNLANLYSSGIMASAKAAQTVGHVEELIGLLKTASAGGGTTAYCLNSGSA… |
| A0A1J0RBL3 | 2-332 | ADLKTAIEATESAATLAGAIIGTIDVFAVTKHDSVYCHGNTDGSGDDTAQKAAYGCEYKLNELQASATLLTSDNIDTAGYTKLADSS… |
| A0A1J0RCW7 | 7-285 | None |
| A0A1J0RCZ7 | 4-244 | None |
| A0A1J0RD21 | 10-269 | None |
| A0A1J0RDB0 | 11-255 | None |
| A0A1V0FYI9 | 6-235 | None |
| A0A1V0FYL8 | 2-291 | None |
| A0A1V0FYV9 | 1-427 | None |
| A0A1V0FZ73 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.