DPCstruct | MC10919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 42 ± 2 aa |
| Standard deviation of domain lengths | 2.40 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 77.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3YXY3 | 103-142 | ALGNVIATNDHIALVHPDLERETEEIIADVLGVEVFRQTV |
| A0A2E8AHL3 | 1-47 | MTFLALGNCISCNDYTALIHPDIDRETEELICDVLGVEAFREVILFV |
| A0A072VXT9 | 99-141 | None |
| R4XEF2 | 525-564 | None |
| K8ENR1 | 198-237 | None |
| A0A0P1AIE3 | 795-833 | None |
| A0A5A7Q913 | 118-160 | None |
| A0A364LD49 | 103-142 | None |
| A0A553HTR8 | 689-731 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.