DPCstruct | MC10918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 63.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03840 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0ESH0 | 1-103 | MQIFVIIVHFVVVIALVGVVLIQRSEGGILGMGDGSRFLSPRGAVDALTRITAILAGLFFITSIVLGILLRYDYDAKDIINRIPKNS… |
| A0A2E6NYW2 | 1-105 | MSSVILVIHLIVAVVLIVLILLQRSEGGGLGIGGAGDFMSGRAAGNILSRLTGIFALVFFVTSLSLALLSSINQKSGIIDGVKTEEI… |
| A0A1E2S1V4 | 1-101 | None |
| A0A368A321 | 1-96 | None |
| A0A2A4UPG6 | 1-99 | None |
| A0A831ZJ62 | 1-111 | None |
| A0A2E5DTJ8 | 1-105 | None |
| A0A2M8CWW7 | 1-120 | None |
| A0A2E6CBV9 | 1-105 | None |
| A0A2E9UBJ4 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.