DPCstruct | MC10917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A346DRT1 | 5-102 | VEKMIALGGAEWIRDEMHRIYFNADVTAELIGFEYCLRKGRVSSAKLNGEKISNARGQEILVALDFGKIWFDVATGEFHSKNIPDTL… |
| A0A4V2XJH6 | 6-107 | AEQVIEIGGREWEKKGKYRVYLNDDIWPDLIGLKVERYNTGNICAAWLDGDRISNSRANDILLAIAKVYWDSADGQIHIWTRSAGRY… |
| I0R7T1 | 3-96 | None |
| A4QII2 | 7-97 | None |
| A0A847V6P1 | 30-125 | None |
| A0A1I6AMH1 | 42-138 | None |
| A0A343VR79 | 2-96 | None |
| A0A1H6Q653 | 4-101 | None |
| A0A7W7QZ60 | 54-159 | None |
| A0A1I0D6P4 | 41-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.