DPCstruct | MC10916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9SYB3 | 65-136 | QERANRAAVFYPKTDLDTLPCIEVAGVLTYLYLDSEGVLQVSIHLDTTDPGLVRPDATVPLRVMVGDDIVFD |
| A0A4R4N1W5 | 5-84 | MTRAEEEVANKAAHFWPQGDHAVDGTRPAIEVAGAMVFAYVEGGELWVSVDLDETDSRLTREDNTVPLRVTVQGTQVFVA |
| A0A2U2YY00 | 69-141 | None |
| A0A367ESL5 | 409-480 | None |
| A0A6G2XC54 | 7-83 | None |
| A0A495QWZ0 | 163-251 | None |
| A0A4U5W590 | 164-245 | None |
| A0A327TZR0 | 41-121 | None |
| A0A3N9XUM7 | 173-249 | None |
| A0A561SA15 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.