DPCstruct | MC10914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1GVE3 | 1-75 | MTNSLVNHAASAAAAKAEPGVWKFVGNYPSAQSAAAIANHVRGGRQLAAYQPGGTFEAYHAIAASGWSVWTRYVA |
| A0A1M6CXM2 | 1-81 | MSRPNARPRVDHQHAADQARQMPGQWVLAGTYGSSASAQSAALQVRTGEKAPAYRPAGAFEGRTLVTQDGADLWVRYTRSD |
| A0A1Q4YKC9 | 1-79 | None |
| A0A3B7QMZ2 | 1-83 | None |
| A0A1H9U4W0 | 2-81 | None |
| A0A495M2Y8 | 3-77 | None |
| A0A3A1XSC7 | 24-130 | None |
| A0A561EN30 | 1-80 | None |
| A0A1Q4B7T2 | 19-114 | None |
| A0A4R7BZ76 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.