DPCstruct | MC10913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 12.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1RGI5 | 92-201 | LDHFRGRLDDAEHGVYEVRRVAKARAQGAKPVIARSVRLLERGSERDMMTALAAMPGQLRTARDGIARSVVLPRREAPPWAEHFYVV… |
| A0A1M5S5Z1 | 2-114 | LAAFKEELACPWALYHVPRILPVAKADPTRRGRALRSVERVDVGRASALGRRLRSVSERRGIPVEVDERYGRVRAWVQRRGLELPTV… |
| A0A4Z0N725 | 23-141 | None |
| A0A0U3GJX1 | 32-148 | None |
| A0A229SDS5 | 24-156 | None |
| A0A5Q0H3Q9 | 226-349 | None |
| A0A5D0TS10 | 2-104 | None |
| A0A1Z4JRH0 | 396-525 | None |
| A0A426U253 | 158-262 | None |
| A0A561F723 | 5-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.