DPCstruct | MC10911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 161 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6APM6 | 1-158 | MIPLEDYVLFRDQGLLGGGYANGITHRRNPMRDAAFAELLVTTGVRLEEGASLLIGELPTTNARVFHGCRSTMIDLPARITKGRKPR… |
| A0A2V1NZ49 | 1-148 | MPRRGFRGRWAARNAAYADWMVRTGLLLCEHSALTVFDLLELPPAVSGVVNARAVLPHAISKGRSGRAVYWPVSVLRDVRDYMEWDR… |
| A0A0H5CN30 | 147-321 | None |
| A0A7W7PYR6 | 66-214 | None |
| A0A2C8XNN0 | 175-343 | None |
| A0A1U9R209 | 26-197 | None |
| A0A371XQK9 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.