DPCstruct | MC1091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6SUA8 | 7-94 | YYLRVEEAVQCYLDRKDRLEHPDGEFDSASRWYPSDQEEQDCCKDIRSPSRNYPYSLMLHCRTKKHIANLYQVETKDMNVIIRSIRAA |
| A0A7G9NUU6 | 22-101 | EDIKRRVVFVARRDRILHPDGTFDRGGRWYPTDAEDCGVTKYIRSPSRAYPYSYLVACRTLKHCRQLPMEIIEMSLKQIT |
| A0A1M5WNN7 | 10-92 | None |
| A0A1H3NJ81 | 16-105 | None |
| A0A1C2G2V9 | 31-117 | None |
| A0A1G7YG84 | 21-112 | None |
| A0A2E5G2A3 | 4-87 | None |
| A0A1C2I796 | 35-125 | None |
| E8U616 | 42-132 | None |
| A0A3B8L380 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.