DPCstruct | MC10909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7KZD1 | 78-179 | EVLPVATTRLSRYETCVLEPSDFRYDNYVVYITTRGNGRWLVQHGERSLSADLTWSKGLHPYGRPGWEKAHLFDFETARALAEQAAP… |
| A0A2V1NVL1 | 101-193 | HVSVTRYEVSVLPEGDINRPVYTINVEARGRDCWAVVHHRQCLNTKGEWSWESIPSERGAAWLAEHRFDLNTALTLARQAAPRLVVN… |
| A0A109BL60 | 1-87 | None |
| A0A2W1Y830 | 67-184 | None |
| A0A7Y6A9W5 | 165-267 | None |
| A0A4R6P0G3 | 1-86 | None |
| A0A031HQU9 | 49-132 | None |
| A0A327VF87 | 26-126 | None |
| A0A3N8CJQ6 | 4-86 | None |
| A0A1V1W9A7 | 3-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.