DPCstruct | MC10906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0169- PF18821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521WIH0 | 9-113 | SPPRGRRGEVITGRLQEHGKANYQFQADGSPSYYLTLLTSRGPETLWGTDLERAIARSESQPKIGAVVGVQRVGSDAVTIPARDGER… |
| A0A2U0WK80 | 2-95 | LREWGEKRFPDGKRPGKTYESFCVTLEHRGETHVLQGEGLRDAIAESACRIGDRVEVKRIGKTKVPAVDGRGRPKLDASGEQVLWDK… |
| A0A2K4W4D3 | 384-490 | None |
| A0A370XCI9 | 320-417 | None |
| E1VAM4 | 59-165 | None |
| A0A1E9JVJ6 | 732-827 | None |
| A0A0P7H0A4 | 6-103 | None |
| B7UEZ2 | 865-958 | None |
| A0A7U5PH33 | 1-96 | None |
| A0A1B8Q4H9 | 6-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.