DPCstruct | MC10904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S6Z911 | 3-83 | KNRTARLETRLRPEDKQLIETAAAMEGLSLSDFVLVAVKHHAEDVLARHQHIQLSEMVSRQFTEMLLDQTARSPQALRDAM |
| A0A521W4T1 | 7-112 | PARRSRAVANDSARGRVSARLPKALQSRLAAAAELVGATVNQFMVQAALEKAEQVIEHERVIKLSTRDVQQLLTALECPRPPNDRLQ… |
| A0A6C2CCN2 | 33-139 | None |
| A0A1V8QGA2 | 107-229 | None |
| A0A653ETC8 | 18-122 | None |
| A0A179B4U0 | 3-87 | None |
| A0A3L7JD22 | 29-116 | None |
| A0A7Y1DHG1 | 13-84 | None |
| A0A3E1RU86 | 1-79 | None |
| A0A351MBQ1 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.