DPCstruct | MC10903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521R9P6 | 17-125 | SYEVDQLKGWARFPKDGERFEALDNVEVDYLTHWQAPFTGGGKGTLTKGTRIRVTVDAKRPEPVGVNAYPLDKSLEKLLVPEAERTS… |
| A0A2A5DB61 | 22-137 | EEIIKQKNDLRSSFPKDLIYPKDGEVYISTCDFKIDYLTSHNAPFTGGDKAILPKGEQIKIRKPIEDQPINVYCDPINYDKIHNNIV… |
| A0A7C1HKX7 | 4-99 | None |
| A0A2S6IMH3 | 13-114 | None |
| A0A7V3TXR6 | 2-122 | None |
| A0A521G5F0 | 52-163 | None |
| A0A2T7Q1T5 | 36-149 | None |
| A0A1H5RY37 | 13-112 | None |
| A0A553G7I0 | 1-96 | None |
| A0A554UFG2 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.