DPCstruct | MC109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 65.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6L602 | 1-125 | MPARVRMPANNYMSTSATLQTHGIWKHTIKYDPHASEEEKRKELSREEDLKHGDDYNAQARSLFQLAASQMEGRGGHQPGYTPGACK… |
| A0A813EAJ4 | 2-111 | PPANNRLSTSDSLATTEVWQKVVKYDPYAGGDEGDAVSSSIPEGGEINSSAKGLFRLAQLTGNSSTLAPGACKKCGQVGHLYFQCRN… |
| A0A7S0HZ67 | 64-179 | None |
| A0A482S6F8 | 5-116 | None |
| A0A438G0U4 | 1-163 | None |
| A0A0P1AKJ1 | 9-120 | None |
| A0A6V7PSY3 | 1-142 | None |
| K3WEW1 | 1-134 | None |
| A0A6I9RS69 | 1-145 | None |
| A0A2C6KZU4 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.