DPCstruct | MC10899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6XFY7 | 3-64 | EMVANVVSLAHYDRLSIQGDFARKFATELSAAASLGLVSTETPEGFGRVWRATAKGILWLEG |
| A0A3S0EPQ7 | 2-59 | VLDEARWNPFTTKGDFARKHADIIAMAASDGLLTTRIATGFYGRKWSVTATGLRRLET |
| A0A7X6FNL5 | 120-186 | None |
| A0A1A9T4I6 | 4-71 | None |
| A0A2A4Z213 | 11-75 | None |
| A0A2R7SD65 | 1-63 | None |
| A0A1L3ZS68 | 9-71 | None |
| A0A7W6N6M1 | 7-71 | None |
| A0A1X7KQA6 | 4-73 | None |
| A0A6I3KEY0 | 5-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.