DPCstruct | MC10895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523UIF0 | 19-133 | ELLFHFGIAEAGSPGAVLDKATARATPCSCFTYKGKDMCWSKGVVGLLTQPQQDIYCVAGKTYKARPALTERYTRFAEAAEEAHKKI… |
| A0A257AMG7 | 19-126 | DYIENGRVVDEEVAKSTPCKCYKTKKGTLLCWSPGVIGTLNKRQIEIYCKEGKSIKEAPEALEQRLEIMAKASKKCAIGNVVEIEGK… |
| X1T7N4 | 2-93 | None |
| A0A497MRJ4 | 12-106 | None |
| A0A662VMZ8 | 1-107 | None |
| A0A419DB77 | 573-697 | None |
| A0A662QGI8 | 32-145 | None |
| A0A1W9RQI8 | 2-107 | None |
| X1SBI5 | 64-185 | None |
| X1ULG0 | 28-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.