DPCstruct | MC10894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 180 ± 19 aa |
| Standard deviation of domain lengths | 18.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.18 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF07364- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257AJV0 | 18-190 | SRMRIVVGGIGHESNTFSPLLTGIEDFRVIEGDKLLKEESSKFLISEGAEVIPTLIAKAIPSGVVKKDTYMKLKERLLRGISEAGKI… |
| A0A4R1ZWW2 | 1-182 | MKLAVIGMYHETNTFAPGRTGLEAFSTEWVLGNDEFLSRYRDTRTSMGGVIDAVCSEGIELACGLYAGAVPSGMIAADAADHLIGAV… |
| R8BHQ3 | 346-530 | None |
| A0A4R9EU57 | 358-522 | None |
| A0A3M1D9S7 | 138-351 | None |
| A0A4P5SSF6 | 7-192 | None |
| A0A3C1GCK7 | 1-146 | None |
| A0A0D2H738 | 3-163 | None |
| A0A3D8SX90 | 234-417 | None |
| A0A2E3IWZ4 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.