DPCstruct | MC10893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 131 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0689 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5MYV9 | 36-157 | RSGRLSFAYEPITEDTPQEAYRKVLEQAGCSLVRDDYDNEIISQIKRGVSPYGNNGFIDTPAQAGGWPELRKGTSLLDSDDDGMPDE… |
| A0A850STF6 | 337-468 | FYVKAAPQGSGVLSLDAASISGPQQAYRDVLSFAGATRPVRDAADARIANEVRGCAGGIIDHPSERGGWPTLQSLPAPADADRDGMA… |
| C9SA50 | 167-269 | None |
| A0A2A2QP58 | 9-112 | None |
| A0A2E2TNI2 | 380-502 | None |
| A0A7Y7E1R7 | 421-556 | None |
| A0A833GL38 | 155-283 | None |
| A0A519S9H1 | 8-112 | None |
| A0A7C6GBV0 | 713-853 | None |
| A0A6I7MEB8 | 28-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.