DPCstruct | MC10890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 287 ± 71 aa |
| Standard deviation of domain lengths | 70.74 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109LIU4 | 83-383 | WDTRQLALLDSRSQWKVRQVASERRALVNELNYSYRFLTQFTRSEQTASAVNKRELNVLGRRLYAAFERKAGKVEFINPGIAPDLAE… |
| A0A426QJJ9 | 95-391 | WSDGHLQLLDTRPQWKIHQVLEERQILVDALRQSYQALSDFARIQDDDHTIDPAELNLLGRRLYAAFERKAGKVDLVNPGISDDLSE… |
| A0A3B0LZX6 | 306-701 | None |
| A0A6L2ZQ34 | 419-665 | None |
| A0A090PMH9 | 4-248 | None |
| A0A3D6C5G3 | 4-231 | None |
| A0A355B1N9 | 414-767 | None |
| A0A7V5HA50 | 12-258 | None |
| A0A6I4KMG4 | 136-439 | None |
| A0A380QEA4 | 235-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.