DPCstruct | MC1089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 2.53 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4JFH0 | 3-73 | LNPIEIKGGHRWQIYHRLCELGIACTCNAYEPLIVKVETPIALVQLWSVAKHITTPRQTQIAWLETCWNCR |
| A0A2D2Q160 | 5-75 | PIVIAVNWQLRWSIYQRLTLLGISCRYAPHQPLEVEVHSPTTALYIWSVVRQLTADRATLVNWLERCWQLQ |
| K1WAS1 | 44-111 | None |
| A0A0P7ZMT2 | 28-99 | None |
| A0A3C1M1Y3 | 50-121 | None |
| A0A6P0TC27 | 2-66 | None |
| A0A0P7Z8U9 | 44-116 | None |
| A0A6H2NIW6 | 21-89 | None |
| A0A5Q4EDJ3 | 20-92 | None |
| A0A2T1GNG1 | 9-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.