DPCstruct | MC10889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5GT64 | 20-112 | EAALTGHLVLSTLHTNDAPGALPRLIDMGVEPFLVASSIGGVLAQRLVRRICSACKVEYEASEALLKTMEMEGEKVKLYKGEGCRAC… |
| A0A3D5YFK6 | 1-107 | MNAALTGHLVFTTLHTNSAIESITRLLNMGVKPYMLAPALNLIVAQRLVRKLCPHCATKRDPQYGEKVEVEETIKKITDANPNMKLE… |
| A0A1V5VI85 | 398-505 | None |
| A0A5M9NVN9 | 77-162 | None |
| A0A7X2MWB9 | 123-211 | None |
| A0A2E8D759 | 165-262 | None |
| A0A7C2XV43 | 1-99 | None |
| A0A2G6PMK9 | 99-201 | None |
| B3E1W0 | 105-199 | None |
| A0A7V1SLG1 | 63-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.