DPCstruct | MC10888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4MJ49 | 2-136 | TIRSRSELNFRYTAGALATVEINLDSLERAGFGLEDILAPALARLAAEDPAASATVYSQSLASVNFGQPCWSLFLAVCGSPAALRAL… |
| A0A3T1A2G1 | 1-143 | MTKVISNPTVIIKRGTLTPAIEIDLDRIAGLHANGGWNQLIELFTAKWIKQHSITGSATIWKFDTFSTSFGHPGYSVFIAQFGLPNS… |
| A0A379ZYT9 | 2-135 | None |
| A0A2E6EP41 | 1-130 | None |
| A0A1V1NW26 | 1-149 | None |
| A0A7W0IU47 | 4-137 | None |
| A0A6I1VTS2 | 2-121 | None |
| A0A329CM11 | 8-132 | None |
| A0A3M4LT16 | 1-131 | None |
| A0A7W4AV70 | 306-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.