DPCstruct | MC10883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 25.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8H112 | 1-92 | MTREEVIQVFKVIAYAYSQFEVSSEKVNVWHKFLKDQNPATVMMKVERHIATEKFPPTIAEITEIKPKKSITQIQHEKMLAEHRAAL… |
| A0A842ADG2 | 1-86 | MTRKEAIELLLLINDAYKDFELDQTKKETWIQILESGDYTRSKAALLKYIQTKPFQPTVANFFVPTNRDVEKTKAYLDKQAAYQQE |
| A0A5S9MDC5 | 105-197 | None |
| R8DID2 | 1-112 | None |
| A0A0Q3QL43 | 1-106 | None |
| A0A4R5ZWG1 | 37-136 | None |
| B7DTS9 | 3-88 | None |
| A0A329MQK5 | 30-118 | None |
| A0A327SCQ7 | 1-79 | None |
| A0A561QKU0 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.