DPCstruct | MC1088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814E4M7 | 2-152 | NKFSNLTQHAENPSYQIDLEQNSHTDLTKKTRNLRIIHCGDGIIEECSEDEEEKERIEREEKRKQEELRAKMELEAKNMPWLPWMAY… |
| S4PX70 | 1-138 | MEGINSDSEVQVTINKPKRVIYFSDGIEEEIEEEKANELQSTPEQIVDPKTLSWVPWFSYYVWKSGSSALNAVDYAGESLAGFFGIT… |
| A0A5B7D7K4 | 21-166 | None |
| A0A654GT60 | 136-237 | None |
| A0A2G8LQF2 | 1-139 | None |
| A0A2I4D2U5 | 18-152 | None |
| A0A177BCX6 | 5-126 | None |
| A0A3B5QN56 | 25-126 | None |
| Q0P461 | 1-128 | None |
| A0A443RMQ5 | 22-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.