DPCstruct | MC10879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R7DA29 | 204-324 | TRRARRIDLWRDGEAGRGDCYFRDSHVDRNGDETVIHEWRLFIEFDPRERLFIAAVAEAGPLPYPECPASGDSAARLVGMPIDGLRR… |
| A0A158DJ35 | 7-138 | SDGLFEVEAILTDRKSHNFTPASGGKTVSPGQPLHNMGVCLVFDAEMTVREAHTFIADAPYDTCVGGGENFRSLEGLRIASGWTGEV… |
| A0A645BKT9 | 2-127 | None |
| A0A2E3K7Z7 | 3-145 | None |
| A0A7Y4U9R3 | 154-290 | None |
| A0A1M7PFJ6 | 1-98 | None |
| A0A353VC88 | 13-119 | None |
| A0A7C5YV63 | 40-173 | None |
| A0A7Y7NTN8 | 3-123 | None |
| B8FDC2 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.