DPCstruct | MC10874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520LH63 | 1-111 | MKDFFSPGSLVTIAGGVLTVVGATAYATGSANLSLPTIFYGIPILLGGLALKSSELPPAIRVTPIKTFQKEREAAAPELGKLLGDVT… |
| A0A7S2QF47 | 23-113 | FSLATVVLFIGAALTVFSALDYTVFSAAGTGFGLGGLTFIYAIPVLVLGAALSYAELQPVEIKVQPDADGLFEKLATPTLKKIKNDV… |
| A0A2J6M122 | 96-201 | None |
| A0A5C0DQ94 | 1-94 | None |
| A0A2H9ZVB1 | 94-199 | None |
| A0A059BSH1 | 148-245 | None |
| A0A6A3C2R9 | 40-143 | None |
| A0A3B6TRL4 | 73-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.