DPCstruct | MC10873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9R1L2 | 31-141 | QSSNAEDLGYDHLAGIGYRKAIEFLVKDYLIEFKNEDRDSISSKLLSQCIKSIDDERIQNLAKAASWIGNDETHYIRKHIDKDIQDL… |
| A0A7H8SCH6 | 5-115 | QSYHAEQIELTLISGIGYRKALEFLIKDYLIYLDNEAETEFLKMPLGQCINKLGNHNIKEIAKRAAWIGNDETHYIRKWKNKDINDL… |
| A0A7X5P959 | 149-261 | None |
| A0A1J4TXQ6 | 124-235 | None |
| A0A6N7SRU6 | 23-130 | None |
| A0A811T3N9 | 2-102 | None |
| A0A3R6FCG1 | 63-190 | None |
| A0A410MDP0 | 107-218 | None |
| A0A2S9VH03 | 2-133 | None |
| A0A7X1HI77 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.