DPCstruct | MC10872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 179 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8S8K3 | 2-163 | REFKGRFWVIFGIWALITAFFHFYTALYGTFEPRLQRSIHLFLLLPLVFLVFPFNKKSKKALPSYADWILSILALLPSLYIIWNIET… |
| A0A455V3Q2 | 2-169 | SIAAVWSLFQLWIASPLPYIVGFGVFSATEARSIHLAFALFLAFMAYPAFKRSPRDRVPLADWALAAVAAFCGAYLFVFYADLAQRP… |
| A0A4U5JA94 | 37-226 | None |
| A0A6B1HP68 | 15-222 | None |
| A0A3N5FMK1 | 6-189 | None |
| A0A7C6ZH52 | 5-196 | None |
| A0A379B7S6 | 29-194 | None |
| A0A0F9T044 | 25-223 | None |
| A0A090P2F7 | 11-158 | None |
| A0A0B0H6R0 | 27-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.