DPCstruct | MC10870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7PFL1 | 1-143 | MCGEVVLNNNWCTGRNERTGEKGDFASEYVYVLPALSKPATNILALFSQDGAENGKKLFQQTPTNGVESREHPHTLEEYSMDFFRPL… |
| A0A821Y555 | 1-155 | MNAGWAHGYNERTKHKGDFPTEIVYVMPSVTKPPSEIVTLVTMTPDQKQDVVRTVQMTTLEQEEKVKPYTLEEFSYDYFRPPPKHTL… |
| A0A210Q6N7 | 723-858 | None |
| A0A3Q2CVW0 | 251-393 | None |
| A0A7R9KLJ7 | 399-539 | None |
| A0A674I1B7 | 382-521 | None |
| A0A817CVR8 | 531-678 | None |
| A0A1X7U4X4 | 4-116 | None |
| A0A4W5M308 | 335-473 | None |
| A0A4Z2H881 | 284-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.