DPCstruct | MC10869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 273 ± 34 aa |
| Standard deviation of domain lengths | 34.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.29 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0003- CL0701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1P0J2 | 1-266 | MGGANFWGGTKEDDTFQAPSFDDKILEVVAVFGSVQMAMSRVIDIQHHRIAQCRRVKITIMGDEAVPAQVDGEAWMQPPGYIHIVHK… |
| A0A3M7QS11 | 254-505 | TGGVNFWGPNSRDENVFISPSFDDKILEVVSISGAIQMALSRVVSLKSNRIAQCRSVKIQILGSEGVPVQVDGEAWIQPPGYIQIIH… |
| A0A6J3D3I0 | 611-925 | None |
| A0A672JXB0 | 3-220 | None |
| A0A3Q2VW43 | 46-310 | None |
| B4I4Y1 | 1535-1846 | None |
| A0A7J8DWI2 | 393-681 | None |
| A0A7R8X479 | 342-639 | None |
| A0A812DEV2 | 553-824 | None |
| A0A1D2N9J9 | 1001-1262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.